PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.04SWW
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 470aa    MW: 51204.7 Da    PI: 5.5646
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.04SWWgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like109.71.5e-34246300155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  kpr+rWtpeLHe+Fv+av+qLGGse+AtPk +l+lmkv+gLt++hvkSHLQkYR+
  Araip.04SWW 246 KPRMRWTPELHEAFVDAVNQLGGSERATPKGVLKLMKVEGLTIYHVKSHLQKYRT 300
                  79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.714243303IPR017930Myb domain
SuperFamilySSF466895.91E-18244300IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.0E-32245302IPR009057Homeodomain-like
TIGRFAMsTIGR015578.1E-25246300IPR006447Myb domain, plants
PfamPF002497.7E-10248299IPR001005SANT/Myb domain
PfamPF143792.9E-26331378IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0016036Biological Processcellular response to phosphate starvation
GO:0055063Biological Processsulfate ion homeostasis
GO:0071486Biological Processcellular response to high light intensity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 470 aa     Download sequence    Send to blast
MKAHPAKQLN NMGMSGALPS SLASLPPSLE DTYSKLSDSQ PAFVENELTT RPFTHSSSSG  60
VVGPMFSSSP GYSTDLHHSS LSPHDKQSKN THFLSPTFGN IASLPLPYSS NNGPIPSTTP  120
THYSKGNSAS WHADSLNSFL DLPTSTPIDS SQVESSACNI MASEDYSKQN NWQEWADQLI  180
SDDDTLTSNW NDILVDNIQD LEPKVVFQVP KSSSQFPAAH QQLPASSGEN HVGATPSSSA  240
NSAPAKPRMR WTPELHEAFV DAVNQLGGSE RATPKGVLKL MKVEGLTIYH VKSHLQKYRT  300
ARYRPESSEG SSEKKLGTIE EMPSLDLKTG IEITEALRMQ MEVQKRLHEQ LEIQRNLQLR  360
IEEQGRYLQM MFEKQCKSGG IEPFKASSSA IDSTSGVSSD AMKDSPAKSE MEAIPVDLCS  420
SGPHQANGNA TAEKKSLEVS GKQDAPEDPK QLASESEDSG HPPKRPRTDE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016207364.10.0PREDICTED: protein PHR1-LIKE 1 isoform X1
TrEMBLG7KXD80.0G7KXD8_MEDTR; Myb-like transcription factor family protein
STRINGGLYMA19G35080.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15123498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.13e-88phosphate starvation response 1